PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BS_24DBD38A8.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 230aa    MW: 25607.3 Da    PI: 10.0242
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BS_24DBD38A8.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-153579147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           r rWT eE+e++++a + +G + Wk+I + +  ++t  q++s+ qk+
  Traes_1BS_24DBD38A8.1 35 RERWTDEEHERFLHALHIFGRD-WKSIEALVA-TKTSVQIRSHAQKH 79
                           78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.16E-172985IPR009057Homeodomain-like
PROSITE profilePS5129418.5223084IPR017930Myb domain
SMARTSM007174.5E-113482IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.4E-153482IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.8E-83579IPR009057Homeodomain-like
PfamPF002491.3E-123579IPR001005SANT/Myb domain
CDDcd001671.14E-93780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MATMVRGARM PAAARSSAVG RNKKLRKPYT ITRPRERWTD EEHERFLHAL HIFGRDWKSI  60
EALVATKTSV QIRSHAQKHF LKAQKLGLGA CLPPPLHPRR AAALRQQPPA HSHPDADMLV  120
PSVDWACAPP ESRWPDLDAP GAREWPSAGA LHLQDETVEL PLSPHDLRFA LVYRFVGDVF  180
ASHAAVPVDA QLQRLQLQGV DPVVVDTVST SHAHCHSLSS PRWPNVSHLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3595770.0AK359577.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1099F17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566512.24e-78PREDICTED: protein REVEILLE 6-like
TrEMBLW5A8D71e-167W5A8D7_WHEAT; Uncharacterized protein
STRINGMLOC_5590.31e-135(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.21e-29MYB_related family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]